Lineage for d1zapa_ (1zap A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2058814Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 2058815Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 2060177Family b.50.1.2: Pepsin-like [50646] (11 protein domains)
    duplication: consists of two similar barrel domains
    N-terminal: barrel, partly opened; n*=6, S*=10
  6. 2060178Protein Acid protease [50649] (9 species)
  7. 2060228Species Yeast (Candida albicans) [TaxId:5476] [50653] (4 PDB entries)
  8. 2060232Domain d1zapa_: 1zap A: [26827]
    complexed with a70, zn

Details for d1zapa_

PDB Entry: 1zap (more details), 2.5 Å

PDB Description: secreted aspartic protease from c. albicans
PDB Compounds: (A:) secreted aspartic proteinase

SCOPe Domain Sequences for d1zapa_:

Sequence, based on SEQRES records: (download)

>d1zapa_ b.50.1.2 (A:) Acid protease {Yeast (Candida albicans) [TaxId: 5476]}
qavpvtlhneqvtyaaditvgsnnqklnvivdtgssdlwvpdvnidcqvtysdqtadfck
qkgtydpsgssasqdlntpfsigygdgsssqgtlykdtvgfggvsiknqvladvdstsid
qgilgvgyktneaggsydnvpvtlkkqgviaknayslylnspdsatgqiifggvdnakys
gslialpvtsdrelrislgsvevsgktintdnvdvlldsgttitylqqdladqiikafng
kltqdsngnsfyevdcnlsgdvvfnfsknakisvpasdfaastqgddgqpydkcqllfdv
nkanilgdnflrsayivydlddneisiaqvkytsasstsalt

Sequence, based on observed residues (ATOM records): (download)

>d1zapa_ b.50.1.2 (A:) Acid protease {Yeast (Candida albicans) [TaxId: 5476]}
qavpvtlhneqvtyaaditvgsnnqklnvivdtgssdlwvpdvnidcqvtysdqtadfck
qkgtydpsgssasqdlntpfsigygdgsssqgtlykdtvgfggvsiknqvladvdstsid
qgilgvgyktneaggsydnvpvtlkkqgviaknayslylnspdsatgqiifggvdnakys
gslialpvtsdrelrislgsvevsgktintdnvdvlldsgttitylqqdladqiikafng
kltqdsngnsyevdcnlsgdvvfnfsknakisvpasdfaastqgddgqpydkcqllfdvn
kanilgdnflrsayivydlddneisiaqvkytsasstsalt

SCOPe Domain Coordinates for d1zapa_:

Click to download the PDB-style file with coordinates for d1zapa_.
(The format of our PDB-style files is described here.)

Timeline for d1zapa_: