Lineage for d1eaga_ (1eag A:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 15694Fold b.50: Acid proteases [50629] (1 superfamily)
  4. 15695Superfamily b.50.1: Acid proteases [50630] (2 families) (S)
  5. 15989Family b.50.1.2: Pepsin-like [50646] (9 proteins)
  6. 15990Protein Acid protease [50649] (5 species)
  7. 16024Species Yeast (Candida albicans) [TaxId:5476] [50653] (2 PDB entries)
  8. 16025Domain d1eaga_: 1eag A: [26826]

Details for d1eaga_

PDB Entry: 1eag (more details), 2.1 Å

PDB Description: Secreted aspartic proteinase (SAP2) from Candida albicans complexed with A70450

SCOP Domain Sequences for d1eaga_:

Sequence, based on SEQRES records: (download)

>d1eaga_ b.50.1.2 (A:) Acid protease {Yeast (Candida albicans)}
qavpvtlhneqvtyaaditvgsnnqklnvivdtgssdlwvpdvnvdcqvtysdqtadfck
qkgtydpsgssasqdlntpfkigygdgsssqgtlykdtvgfggvsiknqvladvdstsid
qgilgvgyktneaggsydnvpvtlkkqgviaknayslylnspdaatgqiifggvdnakys
gslialpvtsdrelrislgsvevsgktintdnvdvlldsgttitylqqdladqiikafng
kltqdsngnsfyevdcnlsgdvvfnfsknakisvpasefaaslqgddgqpydkcqllfdv
ndanilgdnflrsayivydlddneislaqvkytsassisalt

Sequence, based on observed residues (ATOM records): (download)

>d1eaga_ b.50.1.2 (A:) Acid protease {Yeast (Candida albicans)}
qavpvtlhneqvtyaaditvgsnnqklnvivdtgssdlwvpdvnvdcqvtysdqtadfck
qkgtydpsgssasqdlntpfkigygdgsssqgtlykdtvgfggvsiknqvladvdstsid
qgilgvgyktneaggsydnvpvtlkkqgviaknayslylnspdaatgqiifggvdnakys
gslialpvtsdrelrislgsvevsgktintdnvdvlldsgttitylqqdladqiikafng
kltqdsngnsfyevdcnlsgdvvfnfsknakisvpasefaasldgqpydkcqllfdvnda
nilgdnflrsayivydlddneislaqvkytsassisalt

SCOP Domain Coordinates for d1eaga_:

Click to download the PDB-style file with coordinates for d1eaga_.
(The format of our PDB-style files is described here.)

Timeline for d1eaga_: