Lineage for d2rmpa_ (2rmp A:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 562942Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 562943Superfamily b.50.1: Acid proteases [50630] (2 families) (S)
  5. 563392Family b.50.1.2: Pepsin-like [50646] (10 proteins)
    duplication: consists of two similar barrel domains
    N-terminal: barrel, partly opened; n*=6, S*=10
  6. 563393Protein Acid protease [50649] (9 species)
  7. 563439Species Rhizomucor miehei [TaxId:4839] [50652] (2 PDB entries)
  8. 563441Domain d2rmpa_: 2rmp A: [26825]
    complexed with iva, man, nag, sta

Details for d2rmpa_

PDB Entry: 2rmp (more details), 2.7 Å

PDB Description: rmp-pepstatin a complex

SCOP Domain Sequences for d2rmpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rmpa_ b.50.1.2 (A:) Acid protease {Rhizomucor miehei}
dgsvdtpgyydfdleeyaipvsigtpgqdflllfdtgssdtwvphkgctksegcvgsrff
dpsasstfkatnynlnitygtgganglyfedsiaigditvtkqilayvdnvrgptaeqsp
nadifldglfgaaypdntameaeygstyntvhvnlykqglissplfsvymntnsgtgevv
fggvnntllggdiaytdvmsryggyyfwdapvtgitvdgsaavrfsrpqaftidtgtnff
impssaaskivkaalpdatetqqgwvvpcasyqnskstisivmqksgsssdtieisvpvs
kmllpvdqsnetcmfiilpdggnqyivgnlflrffvnvydfgnnrigfaplasayene

SCOP Domain Coordinates for d2rmpa_:

Click to download the PDB-style file with coordinates for d2rmpa_.
(The format of our PDB-style files is described here.)

Timeline for d2rmpa_: