SCOP 1.69: Domain d2rmpa_: 2rmp A:

Lineage for d2rmpa_ (2rmp A:)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (2 families)

5. Family b.50.1.2: Pepsin-like [50646] (10 proteins)
   duplication: consists of two similar barrel domains
   N-terminal: barrel, partly opened; n*=6, S*=10

6. Protein Acid protease [50649] (9 species)

7. Species Rhizomucor miehei [TaxId:4839] [50652] (2 PDB entries)

8. Domain d2rmpa_: 2rmp A: [26825]

Details for d2rmpa_

PDB Entry: 2rmp, 2.7 Å

PDB Description: rmp-pepstatin a complex

SCOP Domain Sequences for d2rmpa_:

Sequence; same for both SEQRES and ATOM records:

>d2rmpa_ b.50.1.2 (A:) Acid protease {Rhizomucor miehei}
dgsvdtpgyydfdleeyaipvsigtpgqdflllfdtgssdtwvphkgctksegcvgsrff
dpsasstfkatnynlnitygtgganglyfedsiaigditvtkqilayvdnvrgptaeqsp
nadifldglfgaaypdntameaeygstyntvhvnlykqglissplfsvymntnsgtgevv
fggvnntllggdiaytdvmsryggyyfwdapvtgitvdgsaavrfsrpqaftidtgtnff
impssaaskivkaalpdatetqqgwvvpcasyqnskstisivmqksgsssdtieisvpvs
kmllpvdqsnetcmfiilpdggnqyivgnlflrffvnvydfgnnrigfaplasayene

Timeline for d2rmpa_:

• d2rmpa_ first appeared (with stable ids) in SCOP 1.55
  
• d2rmpa_ appears in SCOP 1.67
  
• d2rmpa_ appears in SCOP 1.71
  
• d2rmpa_ appears in the current release, SCOPe 2.08