Lineage for d2rmpa_ (2rmp A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2799129Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 2799130Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 2800798Family b.50.1.2: Pepsin-like [50646] (11 proteins)
    duplication: consists of two similar barrel domains
    N-terminal: barrel, partly opened; n*=6, S*=10
  6. 2800799Protein Acid protease [50649] (9 species)
  7. 2800846Species Rhizomucor miehei [TaxId:4839] [50652] (2 PDB entries)
  8. 2800848Domain d2rmpa_: 2rmp A: [26825]
    complexed with nag

Details for d2rmpa_

PDB Entry: 2rmp (more details), 2.7 Å

PDB Description: rmp-pepstatin a complex
PDB Compounds: (A:) mucoropepsin

SCOPe Domain Sequences for d2rmpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rmpa_ b.50.1.2 (A:) Acid protease {Rhizomucor miehei [TaxId: 4839]}
dgsvdtpgyydfdleeyaipvsigtpgqdflllfdtgssdtwvphkgctksegcvgsrff
dpsasstfkatnynlnitygtgganglyfedsiaigditvtkqilayvdnvrgptaeqsp
nadifldglfgaaypdntameaeygstyntvhvnlykqglissplfsvymntnsgtgevv
fggvnntllggdiaytdvmsryggyyfwdapvtgitvdgsaavrfsrpqaftidtgtnff
impssaaskivkaalpdatetqqgwvvpcasyqnskstisivmqksgsssdtieisvpvs
kmllpvdqsnetcmfiilpdggnqyivgnlflrffvnvydfgnnrigfaplasayene

SCOPe Domain Coordinates for d2rmpa_:

Click to download the PDB-style file with coordinates for d2rmpa_.
(The format of our PDB-style files is described here.)

Timeline for d2rmpa_: