![]() | Class b: All beta proteins [48724] (126 folds) |
![]() | Fold b.50: Acid proteases [50629] (1 superfamily) barrel, closed; n=6, S=10, complex topology |
![]() | Superfamily b.50.1: Acid proteases [50630] (2 families) ![]() |
![]() | Family b.50.1.2: Pepsin-like [50646] (9 proteins) duplication: consists of two similar barrel domains N-terminal: barrel, partly opened; n*=6, S*=10 |
![]() | Protein Acid protease [50649] (8 species) |
![]() | Species Rhizomucor miehei [TaxId:4839] [50652] (2 PDB entries) |
![]() | Domain d2asi__: 2asi - [26824] complexed with man, nag |
PDB Entry: 2asi (more details), 2.15 Å
SCOP Domain Sequences for d2asi__:
Sequence; same for both SEQRES and ATOM records: (download)
>d2asi__ b.50.1.2 (-) Acid protease {Rhizomucor miehei} gsvdtpgyydfdleeyaipvsigtpgqdflllfdtgssdtwvphkgctksegcvgsrffd psasstfkatnynlnitygtganglyfedsiaigditvtkqilayvdnvrgptaeqspna difldglfgaaypdntameaeygstyntvhvnlykqglissplfsvymntnsgtgevvfg gvnntllggdiaytdvmsryggyyfwdapvtgitvdgsaavrfsrpqaftidtgtnffim pssaaskivkaalpdatetqqgwvvpcasyqnskstisivmqksgsssdtieisvpvskm llpvdqsnetcmfiilpdggnqyivgnlflrffvnvydfgnnrigfaplasayene
Timeline for d2asi__: