Lineage for d2asi__ (2asi -)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 299835Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 299836Superfamily b.50.1: Acid proteases [50630] (2 families) (S)
  5. 300233Family b.50.1.2: Pepsin-like [50646] (9 proteins)
    duplication: consists of two similar barrel domains
    N-terminal: barrel, partly opened; n*=6, S*=10
  6. 300234Protein Acid protease [50649] (8 species)
  7. 300275Species Rhizomucor miehei [TaxId:4839] [50652] (2 PDB entries)
  8. 300276Domain d2asi__: 2asi - [26824]
    complexed with man, nag

Details for d2asi__

PDB Entry: 2asi (more details), 2.15 Å

PDB Description: aspartic proteinase

SCOP Domain Sequences for d2asi__:

Sequence; same for both SEQRES and ATOM records: (download)

>d2asi__ b.50.1.2 (-) Acid protease {Rhizomucor miehei}
gsvdtpgyydfdleeyaipvsigtpgqdflllfdtgssdtwvphkgctksegcvgsrffd
psasstfkatnynlnitygtganglyfedsiaigditvtkqilayvdnvrgptaeqspna
difldglfgaaypdntameaeygstyntvhvnlykqglissplfsvymntnsgtgevvfg
gvnntllggdiaytdvmsryggyyfwdapvtgitvdgsaavrfsrpqaftidtgtnffim
pssaaskivkaalpdatetqqgwvvpcasyqnskstisivmqksgsssdtieisvpvskm
llpvdqsnetcmfiilpdggnqyivgnlflrffvnvydfgnnrigfaplasayene

SCOP Domain Coordinates for d2asi__:

Click to download the PDB-style file with coordinates for d2asi__.
(The format of our PDB-style files is described here.)

Timeline for d2asi__: