Lineage for d2asi__ (2asi -)
- Root: SCOP 1.57
Class b: All beta proteins [48724] (104 folds) 
Fold b.50: Acid proteases [50629] (1 superfamily) Superfamily b.50.1: Acid proteases [50630] (2 families) 
Family b.50.1.2: Pepsin-like [50646] (9 proteins) Protein Acid protease [50649] (7 species) 
Species Rhizomucor miehei [TaxId:4839] [50652] (2 PDB entries) 
Domain d2asi__: 2asi - [26824]
Details for d2asi__
PDB Entry: 2asi (more details), 2.15 Å
PDB Description: aspartic proteinase
SCOP Domain Sequences for d2asi__:
Sequence; same for both SEQRES and ATOM records: (download)
>d2asi__ b.50.1.2 (-) Acid protease {Rhizomucor miehei}
gsvdtpgyydfdleeyaipvsigtpgqdflllfdtgssdtwvphkgctksegcvgsrffd
psasstfkatnynlnitygtganglyfedsiaigditvtkqilayvdnvrgptaeqspna
difldglfgaaypdntameaeygstyntvhvnlykqglissplfsvymntnsgtgevvfg
gvnntllggdiaytdvmsryggyyfwdapvtgitvdgsaavrfsrpqaftidtgtnffim
pssaaskivkaalpdatetqqgwvvpcasyqnskstisivmqksgsssdtieisvpvskm
llpvdqsnetcmfiilpdggnqyivgnlflrffvnvydfgnnrigfaplasayene
SCOP Domain Coordinates for d2asi__:
Click to download the PDB-style file with coordinates for d2asi__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2asi__:
- d2asi__ first appeared (with stable ids) in SCOP 1.55
- d2asi__ appears in SCOP 1.59
- d2asi__ appears in the current release, SCOPe 2.08, called d2asia_
View in 3D