Lineage for d4co7a1 (4co7 A:1-117)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2931197Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2932720Family d.15.1.3: GABARAP-like [54253] (4 proteins)
    intracellular membrane trafficking and fusion proteins
    automatically mapped to Pfam PF02991
  6. 2932757Protein automated matches [190358] (6 species)
    not a true protein
  7. 2932770Species Human (Homo sapiens) [TaxId:9606] [187279] (33 PDB entries)
  8. 2932800Domain d4co7a1: 4co7 A:1-117 [268235]
    Other proteins in same PDB: d4co7a2, d4co7b2
    automated match to d3dowa_

Details for d4co7a1

PDB Entry: 4co7 (more details), 2 Å

PDB Description: crystal structure of human gate-16
PDB Compounds: (A:) gamma-aminobutyric acid receptor-associated protein-like 2

SCOPe Domain Sequences for d4co7a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4co7a1 d.15.1.3 (A:1-117) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mkwmfkedhslehrcvesakirakypdrvpvivekvsgsqivdidkrkylvpsditvaqf
mwiirkriqlpsekaiflfvdktvpqssltmgqlyekekdedgflyvaysgentfgf

SCOPe Domain Coordinates for d4co7a1:

Click to download the PDB-style file with coordinates for d4co7a1.
(The format of our PDB-style files is described here.)

Timeline for d4co7a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4co7a2