SCOPe 2.05: Domain d4apre_: 4apr E:

Lineage for d4apre_ (4apr E:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (4 families)

5. Family b.50.1.2: Pepsin-like [50646] (11 proteins)
   duplication: consists of two similar barrel domains
   N-terminal: barrel, partly opened; n*=6, S*=10

6. Protein Acid protease [50649] (9 species)

7. Species Bread mold (Rhizopus chinensis) [TaxId:4843] [50651] (8 PDB entries)
   Uniprot P06026 69-393

8. Domain d4apre_: 4apr E: [26823]

Details for d4apre_

PDB Entry: 4apr, 2.5 Å

PDB Description: structures of complexes of rhizopuspepsin with pepstatin and other statine-containing inhibitors

PDB Compounds: (E:) rhizopuspepsin

SCOPe Domain Sequences for d4apre_:

Sequence; same for both SEQRES and ATOM records:

>d4apre_ b.50.1.2 (E:) Acid protease {Bread mold (Rhizopus chinensis) [TaxId: 4843]}
agvgtvpmtdygndieyygqvtigtpgkkfnldfdtgssdlwiastlctncgsgqtkydp
nqsstyqadgrtwsisygdgssasgilakdnvnlggllikgqtielakreaasfasgpnd
gllglgfdtittvrgvktpmdnlisqglisrpifgvylgkaknggggeyifggydstkfk
gslttvpidnsrgwwgitvdratvgtstvassfdgildtgttllilpnniaasvarayga
sdngdgtytiscdtsafkplvfsingasfqvspdslvfeefqgqciagfgygnwgfaiig
dtflknnyvvfnqgvpevqiapvae

Timeline for d4apre_:

• d4apre_ first appeared (with stable ids) in SCOP 1.55
  
• d4apre_ appears in SCOPe 2.04
  
• d4apre_ appears in SCOPe 2.06
  
• d4apre_ appears in the current release, SCOPe 2.08