Class b: All beta proteins [48724] (141 folds) |
Fold b.50: Acid proteases [50629] (1 superfamily) barrel, closed; n=6, S=10, complex topology |
Superfamily b.50.1: Acid proteases [50630] (2 families) |
Family b.50.1.2: Pepsin-like [50646] (9 proteins) duplication: consists of two similar barrel domains N-terminal: barrel, partly opened; n*=6, S*=10 |
Protein Acid protease [50649] (8 species) |
Species Bread mold (Rhizopus chinensis) [TaxId:4843] [50651] (5 PDB entries) |
Domain d6apre_: 6apr E: [26822] complexed with iva, sta |
PDB Entry: 6apr (more details), 2.5 Å
SCOP Domain Sequences for d6apre_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6apre_ b.50.1.2 (E:) Acid protease {Bread mold (Rhizopus chinensis)} agvgtvpmtdygndieyygqvtigtpgkkfnldfdtgssdlwiastlctncgsgqtkydp nqsstyqadgrtwsisygdgssasgilakdnvnlggllikgqtielakreaasfasgpnd gllglgfdtittvrgvktpmdnlisqglisrpifgvylgkaknggggeyifggydstkfk gslttvpidnsrgwwgitvdratvgtstvassfdgildtgttllilpnniaasvarayga sdngdgtytiscdtsafkplvfsingasfqvspdslvfeefqgqciagfgygnwgfaiig dtflknnyvvfnqgvpevqiapvae
Timeline for d6apre_: