SCOP 1.67: Domain d6apre_: 6apr E:

Lineage for d6apre_ (6apr E:)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (2 families)

5. Family b.50.1.2: Pepsin-like [50646] (9 proteins)
   duplication: consists of two similar barrel domains
   N-terminal: barrel, partly opened; n*=6, S*=10

6. Protein Acid protease [50649] (8 species)

7. Species Bread mold (Rhizopus chinensis) [TaxId:4843] [50651] (5 PDB entries)

8. Domain d6apre_: 6apr E: [26822]
   complexed with iva, sta

Details for d6apre_

PDB Entry: 6apr, 2.5 Å

PDB Description: structures of complexes of rhizopuspepsin with pepstatin and other statine-containing inhibitors

SCOP Domain Sequences for d6apre_:

Sequence; same for both SEQRES and ATOM records:

>d6apre_ b.50.1.2 (E:) Acid protease {Bread mold (Rhizopus chinensis)}
agvgtvpmtdygndieyygqvtigtpgkkfnldfdtgssdlwiastlctncgsgqtkydp
nqsstyqadgrtwsisygdgssasgilakdnvnlggllikgqtielakreaasfasgpnd
gllglgfdtittvrgvktpmdnlisqglisrpifgvylgkaknggggeyifggydstkfk
gslttvpidnsrgwwgitvdratvgtstvassfdgildtgttllilpnniaasvarayga
sdngdgtytiscdtsafkplvfsingasfqvspdslvfeefqgqciagfgygnwgfaiig
dtflknnyvvfnqgvpevqiapvae

Timeline for d6apre_:

• d6apre_ first appeared (with stable ids) in SCOP 1.55
  
• d6apre_ appears in SCOP 1.65
  
• d6apre_ appears in SCOP 1.69
  
• d6apre_ appears in the current release, SCOPe 2.08