Lineage for d6apre_ (6apr E:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 61252Fold b.50: Acid proteases [50629] (1 superfamily)
  4. 61253Superfamily b.50.1: Acid proteases [50630] (2 families) (S)
  5. 61569Family b.50.1.2: Pepsin-like [50646] (9 proteins)
  6. 61570Protein Acid protease [50649] (7 species)
  7. 61581Species Bread mold (Rhizopus chinensis) [TaxId:4843] [50651] (5 PDB entries)
  8. 61585Domain d6apre_: 6apr E: [26822]

Details for d6apre_

PDB Entry: 6apr (more details), 2.5 Å

PDB Description: structures of complexes of rhizopuspepsin with pepstatin and other statine-containing inhibitors

SCOP Domain Sequences for d6apre_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6apre_ b.50.1.2 (E:) Acid protease {Bread mold (Rhizopus chinensis)}
agvgtvpmtdygndieyygqvtigtpgkkfnldfdtgssdlwiastlctncgsgqtkydp
nqsstyqadgrtwsisygdgssasgilakdnvnlggllikgqtielakreaasfasgpnd
gllglgfdtittvrgvktpmdnlisqglisrpifgvylgkaknggggeyifggydstkfk
gslttvpidnsrgwwgitvdratvgtstvassfdgildtgttllilpnniaasvarayga
sdngdgtytiscdtsafkplvfsingasfqvspdslvfeefqgqciagfgygnwgfaiig
dtflknnyvvfnqgvpevqiapvae

SCOP Domain Coordinates for d6apre_:

Click to download the PDB-style file with coordinates for d6apre_.
(The format of our PDB-style files is described here.)

Timeline for d6apre_: