Lineage for d5apre_ (5apr E:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 466492Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 466493Superfamily b.50.1: Acid proteases [50630] (2 families) (S)
  5. 466917Family b.50.1.2: Pepsin-like [50646] (10 proteins)
    duplication: consists of two similar barrel domains
    N-terminal: barrel, partly opened; n*=6, S*=10
  6. 466918Protein Acid protease [50649] (9 species)
  7. 466932Species Bread mold (Rhizopus chinensis) [TaxId:4843] [50651] (8 PDB entries)
  8. 466937Domain d5apre_: 5apr E: [26821]

Details for d5apre_

PDB Entry: 5apr (more details), 2.1 Å

PDB Description: structures of complexes of rhizopuspepsin with pepstatin and other statine-containing inhibitors

SCOP Domain Sequences for d5apre_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5apre_ b.50.1.2 (E:) Acid protease {Bread mold (Rhizopus chinensis)}
agvgtvpmtdygndieyygqvtigtpgkkfnldfdtgssdlwiastlctncgsgqtkydp
nqsstyqadgrtwsisygdgssasgilakdnvnlggllikgqtielakreaasfasgpnd
gllglgfdtittvrgvktpmdnlisqglisrpifgvylgkaknggggeyifggydstkfk
gslttvpidnsrgwwgitvdratvgtstvassfdgildtgttllilpnniaasvarayga
sdngdgtytiscdtsafkplvfsingasfqvspdslvfeefqgqciagfgygnwgfaiig
dtflknnyvvfnqgvpevqiapvae

SCOP Domain Coordinates for d5apre_:

Click to download the PDB-style file with coordinates for d5apre_.
(The format of our PDB-style files is described here.)

Timeline for d5apre_: