Lineage for d5apre_ (5apr E:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 61252Fold b.50: Acid proteases [50629] (1 superfamily)
  4. 61253Superfamily b.50.1: Acid proteases [50630] (2 families) (S)
  5. 61569Family b.50.1.2: Pepsin-like [50646] (9 proteins)
  6. 61570Protein Acid protease [50649] (7 species)
  7. 61581Species Bread mold (Rhizopus chinensis) [TaxId:4843] [50651] (5 PDB entries)
  8. 61584Domain d5apre_: 5apr E: [26821]

Details for d5apre_

PDB Entry: 5apr (more details), 2.1 Å

PDB Description: structures of complexes of rhizopuspepsin with pepstatin and other statine-containing inhibitors

SCOP Domain Sequences for d5apre_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5apre_ b.50.1.2 (E:) Acid protease {Bread mold (Rhizopus chinensis)}
agvgtvpmtdygndieyygqvtigtpgkkfnldfdtgssdlwiastlctncgsgqtkydp
nqsstyqadgrtwsisygdgssasgilakdnvnlggllikgqtielakreaasfasgpnd
gllglgfdtittvrgvktpmdnlisqglisrpifgvylgkaknggggeyifggydstkfk
gslttvpidnsrgwwgitvdratvgtstvassfdgildtgttllilpnniaasvarayga
sdngdgtytiscdtsafkplvfsingasfqvspdslvfeefqgqciagfgygnwgfaiig
dtflknnyvvfnqgvpevqiapvae

SCOP Domain Coordinates for d5apre_:

Click to download the PDB-style file with coordinates for d5apre_.
(The format of our PDB-style files is described here.)

Timeline for d5apre_: