Lineage for d3apre_ (3apr E:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 466492Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 466493Superfamily b.50.1: Acid proteases [50630] (2 families) (S)
  5. 466917Family b.50.1.2: Pepsin-like [50646] (10 proteins)
    duplication: consists of two similar barrel domains
    N-terminal: barrel, partly opened; n*=6, S*=10
  6. 466918Protein Acid protease [50649] (9 species)
  7. 466932Species Bread mold (Rhizopus chinensis) [TaxId:4843] [50651] (8 PDB entries)
  8. 466934Domain d3apre_: 3apr E: [26820]

Details for d3apre_

PDB Entry: 3apr (more details), 1.8 Å

PDB Description: binding of a reduced peptide inhibitor to the aspartic proteinase from rhizopus chinensis. implications for a mechanism of action

SCOP Domain Sequences for d3apre_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3apre_ b.50.1.2 (E:) Acid protease {Bread mold (Rhizopus chinensis)}
agvgtvpmtdygndieyygqvtigtpgkkfnldfdtgssdlwiastlctncgsgqtkydp
nqsstyqadgrtwsisygdgssasgilakdnvnlggllikgqtielakreaasfasgpnd
gllglgfdtittvrgvktpmdnlisqglisrpifgvylgkaknggggeyifggydstkfk
gslttvpidnsrgwwgitvdratvgtstvassfdgildtgttllilpnniaasvarayga
sdngdgtytiscdtsafkplvfsingasfqvspdslvfeefqgqciagfgygnwgfaiig
dtflknnyvvfnqgvpevqiapvae

SCOP Domain Coordinates for d3apre_:

Click to download the PDB-style file with coordinates for d3apre_.
(The format of our PDB-style files is described here.)

Timeline for d3apre_: