SCOP 1.69: Domain d2apr__: 2apr -

Lineage for d2apr__ (2apr -)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (2 families)

5. Family b.50.1.2: Pepsin-like [50646] (10 proteins)
   duplication: consists of two similar barrel domains
   N-terminal: barrel, partly opened; n*=6, S*=10

6. Protein Acid protease [50649] (9 species)

7. Species Bread mold (Rhizopus chinensis) [TaxId:4843] [50651] (8 PDB entries)

8. Domain d2apr__: 2apr - [26819]

Details for d2apr__

PDB Entry: 2apr, 1.8 Å

PDB Description: structure and refinement at 1.8 angstroms resolution of the aspartic proteinase from rhizopus chinensis

SCOP Domain Sequences for d2apr__:

Sequence; same for both SEQRES and ATOM records:

>d2apr__ b.50.1.2 (-) Acid protease {Bread mold (Rhizopus chinensis)}
agvgtvpmtdygndieyygqvtigtpgkkfnldfdtgssdlwiastlctncgsgqtkydp
nqsstyqadgrtwsisygdgssasgilakdnvnlggllikgqtielakreaasfasgpnd
gllglgfdtittvrgvktpmdnlisqglisrpifgvylgkaknggggeyifggydstkfk
gslttvpidnsrgwwgitvdratvgtstvassfdgildtgttllilpnniaasvarayga
sdngdgtytiscdtsafkplvfsingasfqvspdslvfeefqgqciagfgygnwgfaiig
dtflknnyvvfnqgvpevqiapvae

Timeline for d2apr__:

• d2apr__ first appeared (with stable ids) in SCOP 1.55
  
• d2apr__ appears in SCOP 1.67
  
• d2apr__ appears in SCOP 1.71
  
• d2apr__ appears in the current release, SCOPe 2.08, called d2apra_