SCOP 1.69: Domain d1apte_: 1apt E:

Lineage for d1apte_ (1apt E:)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (2 families)

5. Family b.50.1.2: Pepsin-like [50646] (10 proteins)
   duplication: consists of two similar barrel domains
   N-terminal: barrel, partly opened; n*=6, S*=10

6. Protein Acid protease [50649] (9 species)

7. Species Fungus (Penicillium janthinellum), penicillopepsin [TaxId:5079] [50650] (14 PDB entries)

8. Domain d1apte_: 1apt E: [26818]

Details for d1apte_

PDB Entry: 1apt, 1.8 Å

PDB Description: crystallographic analysis of a pepstatin analogue binding to the aspartyl proteinase penicillopepsin at 1.8 angstroms resolution

SCOP Domain Sequences for d1apte_:

Sequence; same for both SEQRES and ATOM records:

>d1apte_ b.50.1.2 (E:) Acid protease {Fungus (Penicillium janthinellum), penicillopepsin}
aasgvatntptandeeyitpvtiggttlnlnfdtgsadlwvfstelpasqqsghsvynps
atgkelsgytwsisygdgssasgnvftdsvtvggvtahgqavqaaqqisaqfqqdtnndg
llglafssintvqpqsqttffdtvksslaqplfavalkhqqpgvydfgfidsskytgslt
ytgvdnsqgfwsfnvdsytagsqsgdgfsgiadtgttllllddsvvsqyysqvsgaqqds
naggyvfdcstnlpdfsvsisgytatvpgslinygpsgdgstclggiqsnsgigfsifgd
iflksqyvvfdsdgpqlgfapqa

Timeline for d1apte_:

• d1apte_ first appeared (with stable ids) in SCOP 1.55
  
• d1apte_ appears in SCOP 1.67
  
• d1apte_ appears in SCOP 1.71
  
• d1apte_ appears in the current release, SCOPe 2.08