Lineage for d1apwe_ (1apw E:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1548217Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 1548218Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 1549490Family b.50.1.2: Pepsin-like [50646] (11 proteins)
    duplication: consists of two similar barrel domains
    N-terminal: barrel, partly opened; n*=6, S*=10
  6. 1549491Protein Acid protease [50649] (9 species)
  7. 1549520Species Fungus (Penicillium janthinellum), penicillopepsin [TaxId:5079] [50650] (14 PDB entries)
  8. 1549533Domain d1apwe_: 1apw E: [26817]
    complexed with dmf, hsy, man, so4

Details for d1apwe_

PDB Entry: 1apw (more details), 1.8 Å

PDB Description: crystallographic analysis of transition state mimics bound to penicillopepsin: difluorostatine-and difluorostatone-containing peptides
PDB Compounds: (E:) penicillopepsin

SCOPe Domain Sequences for d1apwe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1apwe_ b.50.1.2 (E:) Acid protease {Fungus (Penicillium janthinellum), penicillopepsin [TaxId: 5079]}
aasgvatntptandeeyitpvtiggttlnlnfdtgsadlwvfstelpasqqsghsvynps
atgkelsgytwsisygdgssasgnvftdsvtvggvtahgqavqaaqqisaqfqqdtnndg
llglafssintvqpqsqttffdtvksslaqplfavalkhqqpgvydfgfidsskytgslt
ytgvdnsqgfwsfnvdsytagsqsgdgfsgiadtgttllllddsvvsqyysqvsgaqqds
naggyvfdcstnlpdfsvsisgytatvpgslinygpsgdgstclggiqsnsgigfsifgd
iflksqyvvfdsdgpqlgfapqa

SCOPe Domain Coordinates for d1apwe_:

Click to download the PDB-style file with coordinates for d1apwe_.
(The format of our PDB-style files is described here.)

Timeline for d1apwe_: