Lineage for d1apwe_ (1apw E:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 61252Fold b.50: Acid proteases [50629] (1 superfamily)
  4. 61253Superfamily b.50.1: Acid proteases [50630] (2 families) (S)
  5. 61569Family b.50.1.2: Pepsin-like [50646] (9 proteins)
  6. 61570Protein Acid protease [50649] (7 species)
  7. 61590Species Fungus (Penicillium janthinellum), penicillopepsin [TaxId:5079] [50650] (14 PDB entries)
  8. 61602Domain d1apwe_: 1apw E: [26817]

Details for d1apwe_

PDB Entry: 1apw (more details), 1.8 Å

PDB Description: crystallographic analysis of transition state mimics bound to penicillopepsin: difluorostatine-and difluorostatone-containing peptides

SCOP Domain Sequences for d1apwe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1apwe_ b.50.1.2 (E:) Acid protease {Fungus (Penicillium janthinellum), penicillopepsin}
aasgvatntptandeeyitpvtiggttlnlnfdtgsadlwvfstelpasqqsghsvynps
atgkelsgytwsisygdgssasgnvftdsvtvggvtahgqavqaaqqisaqfqqdtnndg
llglafssintvqpqsqttffdtvksslaqplfavalkhqqpgvydfgfidsskytgslt
ytgvdnsqgfwsfnvdsytagsqsgdgfsgiadtgttllllddsvvsqyysqvsgaqqds
naggyvfdcstnlpdfsvsisgytatvpgslinygpsgdgstclggiqsnsgigfsifgd
iflksqyvvfdsdgpqlgfapqa

SCOP Domain Coordinates for d1apwe_:

Click to download the PDB-style file with coordinates for d1apwe_.
(The format of our PDB-style files is described here.)

Timeline for d1apwe_: