Lineage for d4ci4a_ (4ci4 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2008476Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2008477Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2008478Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 protein domains)
  6. 2008932Protein Peroxisome proliferator activated receptor alpha, PPAR-alpha [69109] (1 species)
  7. 2008933Species Human (Homo sapiens) [TaxId:9606] [69110] (16 PDB entries)
  8. 2008953Domain d4ci4a_: 4ci4 A: [268152]
    automated match to d3kdub_
    complexed with y1n

Details for d4ci4a_

PDB Entry: 4ci4 (more details), 2.3 Å

PDB Description: structural basis for gl479 a dual peroxisome proliferator- activated receptor alpha agonist
PDB Compounds: (A:) Peroxisome proliferator-activated receptor alpha

SCOPe Domain Sequences for d4ci4a_:

Sequence, based on SEQRES records: (download)

>d4ci4a_ a.123.1.1 (A:) Peroxisome proliferator activated receptor alpha, PPAR-alpha {Human (Homo sapiens) [TaxId: 9606]}
kslakriyeaylknfnmnkvkarvilsgkasnnppfvihdmetlcmaektlvaklvangi
qnkeaevrifhccqctsvetvteltefakaipgfanldlndqvtllkygvyeaifamlss
vmnkdgmlvaygngfitreflkslrkpfcdimepkfdfamkfnalelddsdislfvaaii
ccgdrpgllnvghiekmqegivhvlrlhlqsnhpddiflfpkllqkmadlrqlvtehaql
vqiikktesdaalhpllqeiyrdm

Sequence, based on observed residues (ATOM records): (download)

>d4ci4a_ a.123.1.1 (A:) Peroxisome proliferator activated receptor alpha, PPAR-alpha {Human (Homo sapiens) [TaxId: 9606]}
kslakriyeaylknfnmnkvkarvilsppfvihdmetlcmaektlvkeaevrifhccqct
svetvteltefakaipgfanldlndqvtllkygvyeaifamlssvmnkdgmlvaygngfi
treflkslrkpfcdimepkfdfamkfnalelddsdislfvaaiiccgdrpgllnvghiek
mqegivhvlrlhlqsnhpddiflfpkllqkmadlrqlvtehaqlvqiikktesdaalhpl
lqeiyrdm

SCOPe Domain Coordinates for d4ci4a_:

Click to download the PDB-style file with coordinates for d4ci4a_.
(The format of our PDB-style files is described here.)

Timeline for d4ci4a_: