Lineage for d4cl7d_ (4cl7 D:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2753554Family b.1.1.4: I set domains [49159] (39 proteins)
  6. 2753968Protein automated matches [190803] (3 species)
    not a true protein
  7. 2753969Species Human (Homo sapiens) [TaxId:9606] [188070] (29 PDB entries)
  8. 2754003Domain d4cl7d_: 4cl7 D: [268151]
    automated match to d1qsza_
    complexed with co, edo

Details for d4cl7d_

PDB Entry: 4cl7 (more details), 2 Å

PDB Description: crystal structure of vegfr-1 domain 2 in presence of cobalt
PDB Compounds: (D:) vascular endothelial growth factor receptor 1

SCOPe Domain Sequences for d4cl7d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4cl7d_ b.1.1.4 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rpfvemyseipeiihmtegrelvipcrvtspnitvtlkkfpldtlipdgkriiwdsrkgf
iisnatykeiglltceatvnghlyktnylthrq

SCOPe Domain Coordinates for d4cl7d_:

Click to download the PDB-style file with coordinates for d4cl7d_.
(The format of our PDB-style files is described here.)

Timeline for d4cl7d_: