Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.4: I set domains [49159] (39 proteins) |
Protein automated matches [190803] (2 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188070] (30 PDB entries) |
Domain d4cl7b_: 4cl7 B: [268148] automated match to d1qsza_ complexed with co, edo |
PDB Entry: 4cl7 (more details), 2 Å
SCOPe Domain Sequences for d4cl7b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4cl7b_ b.1.1.4 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} rpfvemyseipeiihmtegrelvipcrvtspnitvtlkkfpldtlipdgkriiwdsrkgf iisnatykeiglltceatvnghlyktnylthrq
Timeline for d4cl7b_: