SCOPe 2.06: Domain d4cl7b_: 4cl7 B:

Lineage for d4cl7b_ (4cl7 B:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.4: I set domains [49159] (39 proteins)

6. Protein automated matches [190803] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188070] (30 PDB entries)

8. Domain d4cl7b_: 4cl7 B: [268148]
   automated match to d1qsza_
   complexed with co, edo

Details for d4cl7b_

PDB Entry: 4cl7, 2 Å

PDB Description: crystal structure of vegfr-1 domain 2 in presence of cobalt

PDB Compounds: (B:) vascular endothelial growth factor receptor 1

SCOPe Domain Sequences for d4cl7b_:

Sequence; same for both SEQRES and ATOM records:

>d4cl7b_ b.1.1.4 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rpfvemyseipeiihmtegrelvipcrvtspnitvtlkkfpldtlipdgkriiwdsrkgf
iisnatykeiglltceatvnghlyktnylthrq

Timeline for d4cl7b_:

• d4cl7b_ first appeared in SCOPe 2.05
  
• d4cl7b_ appears in SCOPe 2.07
  
• d4cl7b_ appears in the current release, SCOPe 2.08