Lineage for d4cl6b_ (4cl6 B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2550604Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 2550605Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families) (S)
  5. 2550748Family d.38.1.2: beta-Hydroxydecanol thiol ester dehydrase [54641] (2 proteins)
    contains two additional beta-strands in the N-terminal extension
  6. 2550759Protein automated matches [191220] (4 species)
    not a true protein
  7. 2550760Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [193354] (7 PDB entries)
  8. 2550809Domain d4cl6b_: 4cl6 B: [268142]
    automated match to d4fq9i_
    complexed with 7sb

Details for d4cl6b_

PDB Entry: 4cl6 (more details), 2.41 Å

PDB Description: crystal structure of 3-hydroxydecanoyl-acyl carrier protein dehydratase (faba) from pseudomonas aeruginosa in complex with n-(4- chlorobenzyl)-3-(2-furyl)-1h-1,2,4-triazol-5-amine
PDB Compounds: (B:) 3-hydroxydecanoyl-[acyl-carrier-protein] dehydratase

SCOPe Domain Sequences for d4cl6b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4cl6b_ d.38.1.2 (B:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
tkqhaftredllrcsrgelfgpgnaqlpapnmlmidrivhisdvggkygkgelvaeldin
pdlwffachfegdpvmpgclgldamwqlvgfylgwqgnpgrgralgsgevkffgqvlpta
kkvtynihikrtinrslvlaiadgtvsvdgreiysaeglrvglftstdsf

SCOPe Domain Coordinates for d4cl6b_:

Click to download the PDB-style file with coordinates for d4cl6b_.
(The format of our PDB-style files is described here.)

Timeline for d4cl6b_: