| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily) core: beta-alpha-beta(4); 2 layers: alpha/beta |
Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families) ![]() |
| Family d.38.1.2: beta-Hydroxydecanol thiol ester dehydrase [54641] (2 proteins) contains two additional beta-strands in the N-terminal extension |
| Protein automated matches [191220] (4 species) not a true protein |
| Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [193354] (7 PDB entries) |
| Domain d4cl6b_: 4cl6 B: [268142] automated match to d4fq9i_ complexed with 7sb |
PDB Entry: 4cl6 (more details), 2.41 Å
SCOPe Domain Sequences for d4cl6b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4cl6b_ d.38.1.2 (B:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
tkqhaftredllrcsrgelfgpgnaqlpapnmlmidrivhisdvggkygkgelvaeldin
pdlwffachfegdpvmpgclgldamwqlvgfylgwqgnpgrgralgsgevkffgqvlpta
kkvtynihikrtinrslvlaiadgtvsvdgreiysaeglrvglftstdsf
Timeline for d4cl6b_:
View in 3DDomains from other chains: (mouse over for more information) d4cl6a_, d4cl6c_, d4cl6d_, d4cl6e_ |