Lineage for d1apve_ (1apv E:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1320913Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 1320914Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 1322142Family b.50.1.2: Pepsin-like [50646] (11 proteins)
    duplication: consists of two similar barrel domains
    N-terminal: barrel, partly opened; n*=6, S*=10
  6. 1322143Protein Acid protease [50649] (9 species)
  7. 1322172Species Fungus (Penicillium janthinellum), penicillopepsin [TaxId:5079] [50650] (14 PDB entries)
  8. 1322182Domain d1apve_: 1apv E: [26814]
    complexed with dmf, man, so4, xys

Details for d1apve_

PDB Entry: 1apv (more details), 1.8 Å

PDB Description: crystallographic analysis of transition state mimics bound to penicillopepsin: difluorostatine-and difluorostatone-containing peptides
PDB Compounds: (E:) penicillopepsin

SCOPe Domain Sequences for d1apve_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1apve_ b.50.1.2 (E:) Acid protease {Fungus (Penicillium janthinellum), penicillopepsin [TaxId: 5079]}
aasgvatntptandeeyitpvtiggttlnlnfdtgsadlwvfstelpasqqsghsvynps
atgkelsgytwsisygdgssasgnvftdsvtvggvtahgqavqaaqqisaqfqqdtnndg
llglafssintvqpqsqttffdtvksslaqplfavalkhqqpgvydfgfidsskytgslt
ytgvdnsqgfwsfnvdsytagsqsgdgfsgiadtgttllllddsvvsqyysqvsgaqqds
naggyvfdcstnlpdfsvsisgytatvpgslinygpsgdgstclggiqsnsgigfsifgd
iflksqyvvfdsdgpqlgfapqa

SCOPe Domain Coordinates for d1apve_:

Click to download the PDB-style file with coordinates for d1apve_.
(The format of our PDB-style files is described here.)

Timeline for d1apve_: