Lineage for d1apve_ (1apv E:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.50: Acid proteases [50629] (1 superfamily) Superfamily b.50.1: Acid proteases [50630] (2 families) 
Family b.50.1.2: Pepsin-like [50646] (9 proteins) Protein Acid protease [50649] (5 species) Species Fungus (Penicillium janthinellum), penicillopepsin [TaxId:5079] [50650] (14 PDB entries) 
Domain d1apve_: 1apv E: [26814]
Details for d1apve_
PDB Entry: 1apv (more details), 1.8 Å
PDB Description: crystallographic analysis of transition state mimics bound to penicillopepsin: difluorostatine-and difluorostatone-containing peptides
SCOP Domain Sequences for d1apve_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1apve_ b.50.1.2 (E:) Acid protease {Fungus (Penicillium janthinellum), penicillopepsin}
aasgvatntptandeeyitpvtiggttlnlnfdtgsadlwvfstelpasqqsghsvynps
atgkelsgytwsisygdgssasgnvftdsvtvggvtahgqavqaaqqisaqfqqdtnndg
llglafssintvqpqsqttffdtvksslaqplfavalkhqqpgvydfgfidsskytgslt
ytgvdnsqgfwsfnvdsytagsqsgdgfsgiadtgttllllddsvvsqyysqvsgaqqds
naggyvfdcstnlpdfsvsisgytatvpgslinygpsgdgstclggiqsnsgigfsifgd
iflksqyvvfdsdgpqlgfapqa
SCOP Domain Coordinates for d1apve_:
Click to download the PDB-style file with coordinates for d1apve_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1apve_:
- d1apve_ appears in SCOP 1.57
- d1apve_ appears in the current release, SCOPe 2.08
View in 3D