![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.50: Acid proteases [50629] (1 superfamily) barrel, closed; n=6, S=10, complex topology |
![]() | Superfamily b.50.1: Acid proteases [50630] (4 families) ![]() |
![]() | Family b.50.1.2: Pepsin-like [50646] (11 proteins) duplication: consists of two similar barrel domains N-terminal: barrel, partly opened; n*=6, S*=10 |
![]() | Protein Acid protease [50649] (9 species) |
![]() | Species Fungus (Penicillium janthinellum), penicillopepsin [TaxId:5079] [50650] (14 PDB entries) |
![]() | Domain d1apve_: 1apv E: [26814] complexed with dmf, man, so4, xys |
PDB Entry: 1apv (more details), 1.8 Å
SCOPe Domain Sequences for d1apve_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1apve_ b.50.1.2 (E:) Acid protease {Fungus (Penicillium janthinellum), penicillopepsin [TaxId: 5079]} aasgvatntptandeeyitpvtiggttlnlnfdtgsadlwvfstelpasqqsghsvynps atgkelsgytwsisygdgssasgnvftdsvtvggvtahgqavqaaqqisaqfqqdtnndg llglafssintvqpqsqttffdtvksslaqplfavalkhqqpgvydfgfidsskytgslt ytgvdnsqgfwsfnvdsytagsqsgdgfsgiadtgttllllddsvvsqyysqvsgaqqds naggyvfdcstnlpdfsvsisgytatvpgslinygpsgdgstclggiqsnsgigfsifgd iflksqyvvfdsdgpqlgfapqa
Timeline for d1apve_: