![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.30: PreATP-grasp domain [52439] (1 superfamily) 3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands possible rudiment form of Rossmann-fold domain |
![]() | Superfamily c.30.1: PreATP-grasp domain [52440] (10 families) ![]() precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function |
![]() | Family c.30.1.0: automated matches [227183] (1 protein) not a true family |
![]() | Protein automated matches [226903] (40 species) not a true protein |
![]() | Species Escherichia coli [TaxId:83333] [268126] (3 PDB entries) |
![]() | Domain d4c5aa1: 4c5a A:1-96 [268135] Other proteins in same PDB: d4c5aa2, d4c5ab2 automated match to d1iowa1 complexed with adp, ds0, gol, mg |
PDB Entry: 4c5a (more details), 1.65 Å
SCOPe Domain Sequences for d4c5aa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4c5aa1 c.30.1.0 (A:1-96) automated matches {Escherichia coli [TaxId: 83333]} mtdkiavllggtsaerevslnsgaavlaglreggidaypvdpkevdvtqlksmgfqkvfi alhgrggedgtlqgmlelmglpytgsgvmasalsmd
Timeline for d4c5aa1: