Lineage for d4c5ab2 (4c5a B:97-306)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2978525Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 2978526Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) (S)
  5. 2978527Family d.142.1.1: ATP-binding domain of peptide synthetases [56060] (4 proteins)
  6. 2978546Protein automated matches [268128] (1 species)
    not a true protein
  7. 2978547Species Escherichia coli [TaxId:83333] [268129] (3 PDB entries)
  8. 2978553Domain d4c5ab2: 4c5a B:97-306 [268134]
    Other proteins in same PDB: d4c5aa1, d4c5ab1
    automated match to d1iova2
    complexed with adp, ds0, gol, mg

Details for d4c5ab2

PDB Entry: 4c5a (more details), 1.65 Å

PDB Description: the x-ray crystal structures of d-alanyl-d-alanine ligase in complex adp and d-cycloserine phosphate
PDB Compounds: (B:) d-alanine--d-alanine ligase

SCOPe Domain Sequences for d4c5ab2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4c5ab2 d.142.1.1 (B:97-306) automated matches {Escherichia coli [TaxId: 83333]}
klrskllwqgaglpvapwvaltraefekglsdkqlaeisalglpvivkpsregssvgmsk
vvaenalqdalrlafqhdeevliekwlsgpeftvailgeeilpsiriqpsgtfydyeaky
lsdetqyfcpagleasqeanlqalvlkawttlgckgwgridvmldsdgqfylleantspg
mtshslvpmaarqagmsfsqlvvrilelad

SCOPe Domain Coordinates for d4c5ab2:

Click to download the PDB-style file with coordinates for d4c5ab2.
(The format of our PDB-style files is described here.)

Timeline for d4c5ab2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4c5ab1