Lineage for d3x16a2 (3x16 A:427-720)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2719957Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2719958Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 2720706Family a.93.1.0: automated matches [191605] (1 protein)
    not a true family
  6. 2720707Protein automated matches [191104] (14 species)
    not a true protein
  7. 2720868Species Synechococcus elongatus [TaxId:1140] [237745] (3 PDB entries)
  8. 2720874Domain d3x16a2: 3x16 A:427-720 [268125]
    automated match to d3ut2a2
    complexed with heb, na; mutant

Details for d3x16a2

PDB Entry: 3x16 (more details), 2.65 Å

PDB Description: crystal structure of the catalase-peroxidase katg w78f mutant from synechococcus elongatus pcc7942
PDB Compounds: (A:) Catalase-peroxidase

SCOPe Domain Sequences for d3x16a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3x16a2 a.93.1.0 (A:427-720) automated matches {Synechococcus elongatus [TaxId: 1140]}
qedliwqdpipagnrnydvqavkdriaasglsiselvstawdsartyrnsdkrggangar
irlapqkdwegnepdrlakvlavlegiaaatgasvadvivlagnvgveqaaraagveivl
pfapgrgdataeqtdtesfavlepihdgyrnwlkqdyaatpeellldrtqllgltapemt
vligglrvlgtnhggtkhgvftdregvltndffvnltdmnylwkpagknlyeicdrktnq
vkwtatrvdlvfgsnsilrayselyaqddnkekfvrdfvaawtkvmnadrfdld

SCOPe Domain Coordinates for d3x16a2:

Click to download the PDB-style file with coordinates for d3x16a2.
(The format of our PDB-style files is described here.)

Timeline for d3x16a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3x16a1