Lineage for d3x15g_ (3x15 G:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2690796Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 2690797Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 2691615Family a.3.1.0: automated matches [191374] (1 protein)
    not a true family
  6. 2691616Protein automated matches [190453] (26 species)
    not a true protein
  7. 2691619Species Aquifex aeolicus [TaxId:224324] [268117] (1 PDB entry)
  8. 2691622Domain d3x15g_: 3x15 G: [268123]
    automated match to d2zxya_
    complexed with hec

Details for d3x15g_

PDB Entry: 3x15 (more details), 1.6 Å

PDB Description: dimeric aquifex aeolicus cytochrome c555
PDB Compounds: (G:) cytochrome c552

SCOPe Domain Sequences for d3x15g_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3x15g_ a.3.1.0 (G:) automated matches {Aquifex aeolicus [TaxId: 224324]}
adgkaifqqkgcgschqanvdtvgpslkkiaqayagkedqlikflkgeapaivdpakeai
mkpqltmlkglsdaelkaladfilshk

SCOPe Domain Coordinates for d3x15g_:

Click to download the PDB-style file with coordinates for d3x15g_.
(The format of our PDB-style files is described here.)

Timeline for d3x15g_: