Class a: All alpha proteins [46456] (286 folds) |
Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
Superfamily a.3.1: Cytochrome c [46626] (9 families) covalently-bound heme completes the core |
Family a.3.1.0: automated matches [191374] (1 protein) not a true family |
Protein automated matches [190453] (18 species) not a true protein |
Species Aquifex aeolicus [TaxId:224324] [268117] (1 PDB entry) |
Domain d3x15d_: 3x15 D: [268121] automated match to d2zxya_ complexed with hec |
PDB Entry: 3x15 (more details), 1.6 Å
SCOPe Domain Sequences for d3x15d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3x15d_ a.3.1.0 (D:) automated matches {Aquifex aeolicus [TaxId: 224324]} adgkaifqqkgcgschqanvdtvgpslkkiaqayagkedqlikflkgeapaivdpakeai mkpqltmlkglsdaelkaladfilshk
Timeline for d3x15d_: