Lineage for d1pple_ (1ppl E:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 61252Fold b.50: Acid proteases [50629] (1 superfamily)
  4. 61253Superfamily b.50.1: Acid proteases [50630] (2 families) (S)
  5. 61569Family b.50.1.2: Pepsin-like [50646] (9 proteins)
  6. 61570Protein Acid protease [50649] (7 species)
  7. 61590Species Fungus (Penicillium janthinellum), penicillopepsin [TaxId:5079] [50650] (14 PDB entries)
  8. 61598Domain d1pple_: 1ppl E: [26812]

Details for d1pple_

PDB Entry: 1ppl (more details), 1.7 Å

PDB Description: crystallographic analysis of transition-state mimics bound to penicillopepsin: phosphorus-containing peptide analogues

SCOP Domain Sequences for d1pple_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pple_ b.50.1.2 (E:) Acid protease {Fungus (Penicillium janthinellum), penicillopepsin}
aasgvatntptandeeyitpvtiggttlnlnfdtgsadlwvfstelpasqqsghsvynps
atgkelsgytwsisygdgssasgnvftdsvtvggvtahgqavqaaqqisaqfqqdtnndg
llglafssintvqpqsqttffdtvksslaqplfavalkhqqpgvydfgfidsskytgslt
ytgvdnsqgfwsfnvdsytagsqsgdgfsgiadtgttllllddsvvsqyysqvsgaqqds
naggyvfdcstnlpdfsvsisgytatvpgslinygpsgdgstclggiqsnsgigfsifgd
iflksqyvvfdsdgpqlgfapqa

SCOP Domain Coordinates for d1pple_:

Click to download the PDB-style file with coordinates for d1pple_.
(The format of our PDB-style files is described here.)

Timeline for d1pple_: