Class b: All beta proteins [48724] (176 folds) |
Fold b.61: Streptavidin-like [50875] (8 superfamilies) barrel, closed; n=8, S=10; meander |
Superfamily b.61.1: Avidin/streptavidin [50876] (2 families) |
Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins) |
Protein automated matches [190191] (2 species) not a true protein |
Species Streptomyces avidinii [TaxId:1895] [189343] (34 PDB entries) |
Domain d3x00b_: 3x00 B: [268114] automated match to d4ekva_ complexed with edn, zof; mutant |
PDB Entry: 3x00 (more details), 1.3 Å
SCOPe Domain Sequences for d3x00b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3x00b_ b.61.1.1 (B:) automated matches {Streptomyces avidinii [TaxId: 1895]} gsaeagitgtwsdqlgdtfivtagadgaltgtyenavgnaesryvltgrydsapatdgsg talgwtvawknnsknahsattwsgqyvggadakintqwlltsgttnanawkstlvghdtf tkvk
Timeline for d3x00b_: