Lineage for d3x00d_ (3x00 D:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1800830Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 1800831Superfamily b.61.1: Avidin/streptavidin [50876] (2 families) (S)
  5. 1800832Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)
  6. 1801148Protein automated matches [190191] (2 species)
    not a true protein
  7. 1801229Species Streptomyces avidinii [TaxId:1895] [189343] (34 PDB entries)
  8. 1801246Domain d3x00d_: 3x00 D: [268113]
    automated match to d4ekva_
    complexed with edn, zof; mutant

Details for d3x00d_

PDB Entry: 3x00 (more details), 1.3 Å

PDB Description: crystal structure of the core streptavidin mutant v212 (y22s/n23d/s27d/s45n/y83s/r84k/e101d/r103k/e116n) complexed with bis iminobiotin long tail (bis-imntail) at 1.3 a resolution
PDB Compounds: (D:) streptavidin

SCOPe Domain Sequences for d3x00d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3x00d_ b.61.1.1 (D:) automated matches {Streptomyces avidinii [TaxId: 1895]}
gsaeagitgtwsdqlgdtfivtagadgaltgtyenavgnaesryvltgrydsapatdgsg
talgwtvawknnsknahsattwsgqyvggadakintqwlltsgttnanawkstlvghdtf
tkvk

SCOPe Domain Coordinates for d3x00d_:

Click to download the PDB-style file with coordinates for d3x00d_.
(The format of our PDB-style files is described here.)

Timeline for d3x00d_:

  • d3x00d_ appears in periodic updates to SCOPe 2.05 starting on 2015-02-20
  • d3x00d_ is called d3x00d1 in SCOPe 2.06
  • d3x00d_ appears in the current release, SCOPe 2.07, called d3x00d1