Lineage for d3x00d1 (3x00 D:13-134)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2805786Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 2805787Superfamily b.61.1: Avidin/streptavidin [50876] (2 families) (S)
  5. 2805788Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)
  6. 2806126Protein automated matches [190191] (2 species)
    not a true protein
  7. 2806221Species Streptomyces avidinii [TaxId:1895] [189343] (100 PDB entries)
  8. 2806240Domain d3x00d1: 3x00 D:13-134 [268113]
    Other proteins in same PDB: d3x00a2, d3x00b2, d3x00c2, d3x00d2
    automated match to d4ekva_
    complexed with edn, zof; mutant

Details for d3x00d1

PDB Entry: 3x00 (more details), 1.3 Å

PDB Description: crystal structure of the core streptavidin mutant v212 (y22s/n23d/s27d/s45n/y83s/r84k/e101d/r103k/e116n) complexed with bis iminobiotin long tail (bis-imntail) at 1.3 a resolution
PDB Compounds: (D:) streptavidin

SCOPe Domain Sequences for d3x00d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3x00d1 b.61.1.1 (D:13-134) automated matches {Streptomyces avidinii [TaxId: 1895]}
aeagitgtwsdqlgdtfivtagadgaltgtyenavgnaesryvltgrydsapatdgsgta
lgwtvawknnsknahsattwsgqyvggadakintqwlltsgttnanawkstlvghdtftk
vk

SCOPe Domain Coordinates for d3x00d1:

Click to download the PDB-style file with coordinates for d3x00d1.
(The format of our PDB-style files is described here.)

Timeline for d3x00d1: