Lineage for d3wyaa2 (3wya A:216-316)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1791673Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 1791735Superfamily b.43.3: Translation proteins [50447] (7 families) (S)
  5. 1792044Family b.43.3.0: automated matches [227211] (1 protein)
    not a true family
  6. 1792045Protein automated matches [226946] (19 species)
    not a true protein
  7. 1792101Species Pyrococcus horikoshii [TaxId:70601] [268109] (1 PDB entry)
  8. 1792102Domain d3wyaa2: 3wya A:216-316 [268110]
    Other proteins in same PDB: d3wyaa1, d3wyaa3
    automated match to d3vmfa2
    complexed with gdp

Details for d3wyaa2

PDB Entry: 3wya (more details), 2.35 Å

PDB Description: crystal structure of gdp-bound ef1alpha from pyrococcus horikoshii
PDB Compounds: (A:) Elongation factor 1-alpha

SCOPe Domain Sequences for d3wyaa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wyaa2 b.43.3.0 (A:216-316) automated matches {Pyrococcus horikoshii [TaxId: 70601]}
pidkplripiqdvysikgvgtvpvgrvetgklkvgdvvifepastifhkpiqgevksiem
hheplqealpgdnigfnvrgvskndikrgdvaghtdkpptv

SCOPe Domain Coordinates for d3wyaa2:

Click to download the PDB-style file with coordinates for d3wyaa2.
(The format of our PDB-style files is described here.)

Timeline for d3wyaa2: