Class b: All beta proteins [48724] (176 folds) |
Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.43.3: Translation proteins [50447] (7 families) |
Family b.43.3.0: automated matches [227211] (1 protein) not a true family |
Protein automated matches [226946] (19 species) not a true protein |
Species Pyrococcus horikoshii [TaxId:70601] [268109] (1 PDB entry) |
Domain d3wyaa2: 3wya A:216-316 [268110] Other proteins in same PDB: d3wyaa1, d3wyaa3 automated match to d3vmfa2 complexed with gdp |
PDB Entry: 3wya (more details), 2.35 Å
SCOPe Domain Sequences for d3wyaa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3wyaa2 b.43.3.0 (A:216-316) automated matches {Pyrococcus horikoshii [TaxId: 70601]} pidkplripiqdvysikgvgtvpvgrvetgklkvgdvvifepastifhkpiqgevksiem hheplqealpgdnigfnvrgvskndikrgdvaghtdkpptv
Timeline for d3wyaa2: