SCOPe 2.05: Domain d1ppme_: 1ppm E:

Lineage for d1ppme_ (1ppm E:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (4 families)

5. Family b.50.1.2: Pepsin-like [50646] (11 proteins)
   duplication: consists of two similar barrel domains
   N-terminal: barrel, partly opened; n*=6, S*=10

6. Protein Acid protease [50649] (9 species)

7. Species Fungus (Penicillium janthinellum), penicillopepsin [TaxId:5079] [50650] (14 PDB entries)

8. Domain d1ppme_: 1ppm E: [26811]
   complexed with 0p1, ara, man, so4

Details for d1ppme_

PDB Entry: 1ppm, 1.7 Å

PDB Description: crystallographic analysis of transition-state mimics bound to penicillopepsin: phosphorus-containing peptide analogues

PDB Compounds: (E:) penicillopepsin

SCOPe Domain Sequences for d1ppme_:

Sequence; same for both SEQRES and ATOM records:

>d1ppme_ b.50.1.2 (E:) Acid protease {Fungus (Penicillium janthinellum), penicillopepsin [TaxId: 5079]}
aasgvatntptandeeyitpvtiggttlnlnfdtgsadlwvfstelpasqqsghsvynps
atgkelsgytwsisygdgssasgnvftdsvtvggvtahgqavqaaqqisaqfqqdtnndg
llglafssintvqpqsqttffdtvksslaqplfavalkhqqpgvydfgfidsskytgslt
ytgvdnsqgfwsfnvdsytagsqsgdgfsgiadtgttllllddsvvsqyysqvsgaqqds
naggyvfdcstnlpdfsvsisgytatvpgslinygpsgdgstclggiqsnsgigfsifgd
iflksqyvvfdsdgpqlgfapqa

Timeline for d1ppme_:

• d1ppme_ first appeared (with stable ids) in SCOP 1.55
  
• d1ppme_ appears in SCOPe 2.04
  
• d1ppme_ appears in SCOPe 2.06
  
• d1ppme_ appears in the current release, SCOPe 2.08