Class b: All beta proteins [48724] (126 folds) |
Fold b.50: Acid proteases [50629] (1 superfamily) barrel, closed; n=6, S=10, complex topology |
Superfamily b.50.1: Acid proteases [50630] (2 families) |
Family b.50.1.2: Pepsin-like [50646] (9 proteins) duplication: consists of two similar barrel domains N-terminal: barrel, partly opened; n*=6, S*=10 |
Protein Acid protease [50649] (8 species) |
Species Fungus (Penicillium janthinellum), penicillopepsin [TaxId:5079] [50650] (14 PDB entries) |
Domain d1ppme_: 1ppm E: [26811] complexed with cbz, man, oph, ple, so4, xys |
PDB Entry: 1ppm (more details), 1.7 Å
SCOP Domain Sequences for d1ppme_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ppme_ b.50.1.2 (E:) Acid protease {Fungus (Penicillium janthinellum), penicillopepsin} aasgvatntptandeeyitpvtiggttlnlnfdtgsadlwvfstelpasqqsghsvynps atgkelsgytwsisygdgssasgnvftdsvtvggvtahgqavqaaqqisaqfqqdtnndg llglafssintvqpqsqttffdtvksslaqplfavalkhqqpgvydfgfidsskytgslt ytgvdnsqgfwsfnvdsytagsqsgdgfsgiadtgttllllddsvvsqyysqvsgaqqds naggyvfdcstnlpdfsvsisgytatvpgslinygpsgdgstclggiqsnsgigfsifgd iflksqyvvfdsdgpqlgfapqa
Timeline for d1ppme_: