Lineage for d3wxoa2 (3wxo A:430-720)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2719957Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2719958Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 2720706Family a.93.1.0: automated matches [191605] (1 protein)
    not a true family
  6. 2720707Protein automated matches [191104] (14 species)
    not a true protein
  7. 2720868Species Synechococcus elongatus [TaxId:1140] [237745] (3 PDB entries)
  8. 2720870Domain d3wxoa2: 3wxo A:430-720 [268108]
    automated match to d3wnua2
    complexed with hem, na, niz

Details for d3wxoa2

PDB Entry: 3wxo (more details), 2.12 Å

PDB Description: Crystal structure of isoniazid bound KatG catalase peroxidase from Synechococcus elongatus PCC7942
PDB Compounds: (A:) Catalase-peroxidase

SCOPe Domain Sequences for d3wxoa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wxoa2 a.93.1.0 (A:430-720) automated matches {Synechococcus elongatus [TaxId: 1140]}
liwqdpipagnrnydvqavkdriaasglsiselvstawdsartyrnsdkrggangarirl
apqkdwegnepdrlakvlavlegiaaatgasvadvivlagnvgveqaaraagveivlpfa
pgrgdataeqtdtesfavlepihdgyrnwlkqdyaatpeellldrtqllgltapemtvli
gglrvlgtnhggtkhgvftdregvltndffvnltdmnylwkpagknlyeicdrktnqvkw
tatrvdlvfgsnsilrayselyaqddnkekfvrdfvaawtkvmnadrfdld

SCOPe Domain Coordinates for d3wxoa2:

Click to download the PDB-style file with coordinates for d3wxoa2.
(The format of our PDB-style files is described here.)

Timeline for d3wxoa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3wxoa1