Lineage for d3wxoa1 (3wxo A:11-429)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2002464Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2002465Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 2003088Family a.93.1.0: automated matches [191605] (1 protein)
    not a true family
  6. 2003089Protein automated matches [191104] (11 species)
    not a true protein
  7. 2003179Species Synechococcus elongatus [TaxId:1140] [237745] (3 PDB entries)
  8. 2003180Domain d3wxoa1: 3wxo A:11-429 [268107]
    automated match to d3wnua1
    complexed with hem, na, niz

Details for d3wxoa1

PDB Entry: 3wxo (more details), 2.12 Å

PDB Description: Crystal structure of isoniazid bound KatG catalase peroxidase from Synechococcus elongatus PCC7942
PDB Compounds: (A:) Catalase-peroxidase

SCOPe Domain Sequences for d3wxoa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wxoa1 a.93.1.0 (A:11-429) automated matches {Synechococcus elongatus [TaxId: 1140]}
mhggattvnistaewwpkalnldilsqhdrktnpmgpdfnyqeevkkldvaalkqdlqal
mtdsqdwwpadwghygglmirltwhaagtyriadgrggagtgnqrfaplnswpdntnldk
arrllwpikqkygnklswadliayagtiayesmglktfgfafgrediwhpekdiywgpek
ewvppstnpnsrytgdrelenplaavtmgliyvnpegvdgnpdplktahdvrvtfarmam
ndeetvaltagghtvgkchgngnaallgpepegadvedqglgwinktqsgigrnavtsgl
egawtphptqwdngyfrmllnydwelkkspagawqwepinpreedlpvdvedpsirrnlv
mtdadmamkmdpeyrkiserfyqdpayfadvfarawfklthrdmgpkaryigpdvpqed

SCOPe Domain Coordinates for d3wxoa1:

Click to download the PDB-style file with coordinates for d3wxoa1.
(The format of our PDB-style files is described here.)

Timeline for d3wxoa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3wxoa2