Lineage for d3wwra_ (3wwr A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2008476Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2008477Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2008478Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 protein domains)
  6. 2009359Protein Vitamin D nuclear receptor [48528] (2 species)
  7. 2009360Species Human (Homo sapiens) [TaxId:9606] [48529] (28 PDB entries)
  8. 2009386Domain d3wwra_: 3wwr A: [268106]
    automated match to d3ilza_
    complexed with 3aj

Details for d3wwra_

PDB Entry: 3wwr (more details), 3.18 Å

PDB Description: crystal structure of the human vitamin d receptor ligand binding domain complexed with 1-((((1s,2r,6r,z)-2,6-dihydroxy-4-((e)-2-((1r, 3as,7ar)-1-((r)-6-hydroxy-6-methylheptan-2-yl)-7a-methylhexahydro-1h- inden-4(2h)-ylidene)ethylidene)-3-methylenecyclohexyl)oxy)methyl) cyclopropanecarbonitrile
PDB Compounds: (A:) Vitamin D3 receptor

SCOPe Domain Sequences for d3wwra_:

Sequence, based on SEQRES records: (download)

>d3wwra_ a.123.1.1 (A:) Vitamin D nuclear receptor {Human (Homo sapiens) [TaxId: 9606]}
dslrpklseeqqriiailldahhktydptysdfcqfrppvrvndgggsvtlelsqlsmlp
hladlvsysiqkvigfakmipgfrdltsedqivllkssaievimlrsnesftmddmswtc
gnqdykyrvsdvtkaghslelieplikfqvglkklnlheeehvllmaicivspdrpgvqd
aalieaiqdrlsntlqtyircrhpppgshllyakmiqkladlrslneehskqyrclsfqp
ecsmkltplvlevfg

Sequence, based on observed residues (ATOM records): (download)

>d3wwra_ a.123.1.1 (A:) Vitamin D nuclear receptor {Human (Homo sapiens) [TaxId: 9606]}
dslrpklseeqqriiailldahhktydptysdfcqfrppvrvndggsvtlelsqlsmlph
ladlvsysiqkvigfakmipgfrdltsedqivllkssaievimlrsnesftmddmswtcg
nqdykyrvsdvtkaghslelieplikfqvglkklnlheeehvllmaicivspdrpgvqda
alieaiqdrlsntlqtyircrhpppgshllyakmiqkladlrslneehskqyrclsfqpe
csmkltplvlevfg

SCOPe Domain Coordinates for d3wwra_:

Click to download the PDB-style file with coordinates for d3wwra_.
(The format of our PDB-style files is described here.)

Timeline for d3wwra_: