Lineage for d3wywa2 (3wyw A:87-214)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712830Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2712831Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2713795Family a.45.1.0: automated matches [227130] (1 protein)
    not a true family
  6. 2713796Protein automated matches [226831] (73 species)
    not a true protein
  7. 2714121Species Nilaparvata lugens [TaxId:108931] [268102] (2 PDB entries)
  8. 2714122Domain d3wywa2: 3wyw A:87-214 [268104]
    Other proteins in same PDB: d3wywa1, d3wywb1
    automated match to d3vk9c2
    complexed with edo, gsh

Details for d3wywa2

PDB Entry: 3wyw (more details), 1.7 Å

PDB Description: Structural characterization of catalytic site of a Nilaparvata lugens delta-class glutathione transferase
PDB Compounds: (A:) glutathione s-transferase

SCOPe Domain Sequences for d3wywa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wywa2 a.45.1.0 (A:87-214) automated matches {Nilaparvata lugens [TaxId: 108931]}
kdpkkrakvnqrlyfdmgtlyqsfgdayyphmfggapldedkkkklgdalvfldgfleks
afvagedltladlaivasistieaveydlspykninswyskvkaaapgykeaneegakgf
gqmfkamt

SCOPe Domain Coordinates for d3wywa2:

Click to download the PDB-style file with coordinates for d3wywa2.
(The format of our PDB-style files is described here.)

Timeline for d3wywa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3wywa1