SCOPe 2.08: Domain d3wywa2: 3wyw A:87-214

Lineage for d3wywa2 (3wyw A:87-214)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.0: automated matches [227130] (1 protein)
   not a true family

6. Protein automated matches [226831] (73 species)
   not a true protein

7. Species Nilaparvata lugens [TaxId:108931] [268102] (2 PDB entries)

8. Domain d3wywa2: 3wyw A:87-214 [268104]
   Other proteins in same PDB: d3wywa1, d3wywb1
   automated match to d3vk9c2
   complexed with edo, gsh

Details for d3wywa2

PDB Entry: 3wyw, 1.7 Å

PDB Description: Structural characterization of catalytic site of a Nilaparvata lugens delta-class glutathione transferase

PDB Compounds: (A:) glutathione s-transferase

SCOPe Domain Sequences for d3wywa2:

Sequence; same for both SEQRES and ATOM records:

>d3wywa2 a.45.1.0 (A:87-214) automated matches {Nilaparvata lugens [TaxId: 108931]}
kdpkkrakvnqrlyfdmgtlyqsfgdayyphmfggapldedkkkklgdalvfldgfleks
afvagedltladlaivasistieaveydlspykninswyskvkaaapgykeaneegakgf
gqmfkamt

Timeline for d3wywa2:

• d3wywa2 first appeared in SCOPe 2.05
  
• d3wywa2 appears in SCOPe 2.07