Class b: All beta proteins [48724] (144 folds) |
Fold b.50: Acid proteases [50629] (1 superfamily) barrel, closed; n=6, S=10, complex topology |
Superfamily b.50.1: Acid proteases [50630] (2 families) |
Family b.50.1.2: Pepsin-like [50646] (10 proteins) duplication: consists of two similar barrel domains N-terminal: barrel, partly opened; n*=6, S*=10 |
Protein Acid protease [50649] (9 species) |
Species Fungus (Penicillium janthinellum), penicillopepsin [TaxId:5079] [50650] (14 PDB entries) |
Domain d2wed__: 2wed - [26810] |
PDB Entry: 2wed (more details), 1.5 Å
SCOP Domain Sequences for d2wed__:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wed__ b.50.1.2 (-) Acid protease {Fungus (Penicillium janthinellum), penicillopepsin} aasgvatntptandeeyitpvtiggttlnlnfdtgsadlwvfstelpasqqsghsvynps atgkelsgytwsisygdgssasgnvftdsvtvggvtahgqavqaaqqisaqfqqdtnndg llglafssintvqpqsqttffdtvksslaqplfavalkhqqpgvydfgfidsskytgslt ytgvdnsqgfwsfnvdsytagsqsgdgfsgiadtgttllllddsvvsqyysqvsgaqqds naggyvfdcstnlpdfsvsisgytatvpgslinygpsgdgstclggiqsnsgigfsifgd iflksqyvvfdsdgpqlgfapqa
Timeline for d2wed__: