SCOP 1.69: Domain d2wed__: 2wed -

Lineage for d2wed__ (2wed -)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (2 families)

5. Family b.50.1.2: Pepsin-like [50646] (10 proteins)
   duplication: consists of two similar barrel domains
   N-terminal: barrel, partly opened; n*=6, S*=10

6. Protein Acid protease [50649] (9 species)

7. Species Fungus (Penicillium janthinellum), penicillopepsin [TaxId:5079] [50650] (14 PDB entries)

8. Domain d2wed__: 2wed - [26810]

Details for d2wed__

PDB Entry: 2wed, 1.5 Å

PDB Description: acid proteinase (penicillopepsin) (e.c.3.4.23.20) complex with phosphonate macrocyclic inhibitor:methyl[cyclo-7[(2r)-((n-valyl) amino)-2-(hydroxyl-(1s)-1-methyoxycarbonyl-2-phenylethoxy) phosphinyloxy-ethyl]-1-naphthaleneacetamide], sodium salt

SCOP Domain Sequences for d2wed__:

Sequence; same for both SEQRES and ATOM records:

>d2wed__ b.50.1.2 (-) Acid protease {Fungus (Penicillium janthinellum), penicillopepsin}
aasgvatntptandeeyitpvtiggttlnlnfdtgsadlwvfstelpasqqsghsvynps
atgkelsgytwsisygdgssasgnvftdsvtvggvtahgqavqaaqqisaqfqqdtnndg
llglafssintvqpqsqttffdtvksslaqplfavalkhqqpgvydfgfidsskytgslt
ytgvdnsqgfwsfnvdsytagsqsgdgfsgiadtgttllllddsvvsqyysqvsgaqqds
naggyvfdcstnlpdfsvsisgytatvpgslinygpsgdgstclggiqsnsgigfsifgd
iflksqyvvfdsdgpqlgfapqa

Timeline for d2wed__:

• d2wed__ first appeared (with stable ids) in SCOP 1.55
  
• d2wed__ appears in SCOP 1.67
  
• d2wed__ appears in SCOP 1.71
  
• d2wed__ appears in the current release, SCOPe 2.08, called d2weda_