Lineage for d2wed__ (2wed -)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 377363Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 377364Superfamily b.50.1: Acid proteases [50630] (2 families) (S)
  5. 377776Family b.50.1.2: Pepsin-like [50646] (9 proteins)
    duplication: consists of two similar barrel domains
    N-terminal: barrel, partly opened; n*=6, S*=10
  6. 377777Protein Acid protease [50649] (8 species)
  7. 377803Species Fungus (Penicillium janthinellum), penicillopepsin [TaxId:5079] [50650] (14 PDB entries)
  8. 377809Domain d2wed__: 2wed - [26810]
    complexed with man, pp6, so4

Details for d2wed__

PDB Entry: 2wed (more details), 1.5 Å

PDB Description: acid proteinase (penicillopepsin) (e.c.3.4.23.20) complex with phosphonate macrocyclic inhibitor:methyl[cyclo-7[(2r)-((n-valyl) amino)-2-(hydroxyl-(1s)-1-methyoxycarbonyl-2-phenylethoxy) phosphinyloxy-ethyl]-1-naphthaleneacetamide], sodium salt

SCOP Domain Sequences for d2wed__:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wed__ b.50.1.2 (-) Acid protease {Fungus (Penicillium janthinellum), penicillopepsin}
aasgvatntptandeeyitpvtiggttlnlnfdtgsadlwvfstelpasqqsghsvynps
atgkelsgytwsisygdgssasgnvftdsvtvggvtahgqavqaaqqisaqfqqdtnndg
llglafssintvqpqsqttffdtvksslaqplfavalkhqqpgvydfgfidsskytgslt
ytgvdnsqgfwsfnvdsytagsqsgdgfsgiadtgttllllddsvvsqyysqvsgaqqds
naggyvfdcstnlpdfsvsisgytatvpgslinygpsgdgstclggiqsnsgigfsifgd
iflksqyvvfdsdgpqlgfapqa

SCOP Domain Coordinates for d2wed__:

Click to download the PDB-style file with coordinates for d2wed__.
(The format of our PDB-style files is described here.)

Timeline for d2wed__: