SCOPe 2.05: Domain d3wywb1: 3wyw B:1-86

Lineage for d3wywb1 (3wyw B:1-86)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (147 species)
   not a true protein

7. Species Nilaparvata lugens [TaxId:108931] [268085] (1 PDB entry)

8. Domain d3wywb1: 3wyw B:1-86 [268099]
   Other proteins in same PDB: d3wywa2, d3wywb2
   automated match to d3vk9a1
   complexed with edo, gsh

Details for d3wywb1

PDB Entry: 3wyw, 1.7 Å

PDB Description: Structural characterization of catalytic site of a Nilaparvata lugens delta-class glutathione transferase

PDB Compounds: (B:) glutathione s-transferase

SCOPe Domain Sequences for d3wywb1:

Sequence; same for both SEQRES and ATOM records:

>d3wywb1 c.47.1.0 (B:1-86) automated matches {Nilaparvata lugens [TaxId: 108931]}
mpidlyyvpgsapcrnvllaakavgvdlnlkltdlksgqhltpefiklnpqhnvptlddn
gfvlnesraimtyladqygkddslyp

Timeline for d3wywb1:

• d3wywb1 is new in SCOPe 2.05-stable
  
• d3wywb1 appears in SCOPe 2.06
  
• d3wywb1 appears in the current release, SCOPe 2.08