SCOPe 2.05: Domain d3wypb_: 3wyp B:

Lineage for d3wypb_ (3wyp B:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.61: Streptavidin-like [50875] (8 superfamilies)
   barrel, closed; n=8, S=10; meander

4. Superfamily b.61.1: Avidin/streptavidin [50876] (2 families)

5. Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)

6. Protein Streptavidin [50878] (1 species)

7. Species Streptomyces avidinii [TaxId:1895] [50879] (124 PDB entries)

8. Domain d3wypb_: 3wyp B: [268095]
   automated match to d1mk5a_
   complexed with bso, btn, gol, so4

Details for d3wypb_

PDB Entry: 3wyp, 1.3 Å

PDB Description: crystal structure of wild-type core streptavidin in complex with d- biotin/biotin-d-sulfoxide at 1.3 a resolution

PDB Compounds: (B:) streptavidin

SCOPe Domain Sequences for d3wypb_:

Sequence; same for both SEQRES and ATOM records:

>d3wypb_ b.61.1.1 (B:) Streptavidin {Streptomyces avidinii [TaxId: 1895]}
eagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgtal
gwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkv
kp

Timeline for d3wypb_:

• d3wypb_ is new in SCOPe 2.05-stable
  
• d3wypb_ appears in SCOPe 2.06
  
• d3wypb_ appears in the current release, SCOPe 2.08