Lineage for d3wxlc1 (3wxl C:1-262)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2883384Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2884835Family c.55.1.0: automated matches [227137] (1 protein)
    not a true family
  6. 2884836Protein automated matches [226839] (64 species)
    not a true protein
  7. 2885651Species Trypanosoma brucei [TaxId:31285] [268052] (13 PDB entries)
  8. 2885656Domain d3wxlc1: 3wxl C:1-262 [268091]
    Other proteins in same PDB: d3wxla3, d3wxlb3, d3wxlc3, d3wxld3
    automated match to d3h3oc1
    complexed with adp, gol, mg

Details for d3wxlc1

PDB Entry: 3wxl (more details), 1.9 Å

PDB Description: Crystal structure of trypanosoma brucei gambiense glycerol kinase complex with adp, mg2+, and glycerol
PDB Compounds: (C:) glycerol kinase

SCOPe Domain Sequences for d3wxlc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wxlc1 c.55.1.0 (C:1-262) automated matches {Trypanosoma brucei [TaxId: 31285]}
mkyvgsidqgttstrfiifderqrpvsvhqvphtqhtphpgwlehdpmeifrsackcmsv
aiaklrqkdasfrkieaigitnqrettvawdrvtkeplcyapvwndlrtyditkkvtael
gggdsmfaskitglpvstyfaafkmrwmlenvpavadacrrgtlcfgtidtwlmyklsgg
kafvtdvtnasrtflmdlrtrkwspelceklkipmetlpeirsnselfgyvetdecgvaa
alnertpimgsigdqqsalfgn

SCOPe Domain Coordinates for d3wxlc1:

Click to download the PDB-style file with coordinates for d3wxlc1.
(The format of our PDB-style files is described here.)

Timeline for d3wxlc1: