Lineage for d2web__ (2web -)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 466492Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 466493Superfamily b.50.1: Acid proteases [50630] (2 families) (S)
  5. 466917Family b.50.1.2: Pepsin-like [50646] (10 proteins)
    duplication: consists of two similar barrel domains
    N-terminal: barrel, partly opened; n*=6, S*=10
  6. 466918Protein Acid protease [50649] (9 species)
  7. 466947Species Fungus (Penicillium janthinellum), penicillopepsin [TaxId:5079] [50650] (14 PDB entries)
  8. 466951Domain d2web__: 2web - [26809]

Details for d2web__

PDB Entry: 2web (more details), 1.5 Å

PDB Description: acid proteinase (penicillopepsin) (e.c.3.4.23.20) complex with phosphonate inhibitor: methyl(2s)-[1-(((n-formyl)-l-valyl)amino-2-(2- naphthyl)ethyl)hydroxyphosphinyloxy]-3-phenylpropanoate, sodium salt

SCOP Domain Sequences for d2web__:

Sequence; same for both SEQRES and ATOM records: (download)

>d2web__ b.50.1.2 (-) Acid protease {Fungus (Penicillium janthinellum), penicillopepsin}
aasgvatntptandeeyitpvtiggttlnlnfdtgsadlwvfstelpasqqsghsvynps
atgkelsgytwsisygdgssasgnvftdsvtvggvtahgqavqaaqqisaqfqqdtnndg
llglafssintvqpqsqttffdtvksslaqplfavalkhqqpgvydfgfidsskytgslt
ytgvdnsqgfwsfnvdsytagsqsgdgfsgiadtgttllllddsvvsqyysqvsgaqqds
naggyvfdcstnlpdfsvsisgytatvpgslinygpsgdgstclggiqsnsgigfsifgd
iflksqyvvfdsdgpqlgfapqa

SCOP Domain Coordinates for d2web__:

Click to download the PDB-style file with coordinates for d2web__.
(The format of our PDB-style files is described here.)

Timeline for d2web__: