Lineage for d3wiim2 (3wii M:108-213)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1758822Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1762660Protein automated matches [190374] (14 species)
    not a true protein
  7. 1763627Species Mouse (Mus musculus) [TaxId:10090] [224855] (368 PDB entries)
  8. 1763673Domain d3wiim2: 3wii M:108-213 [268083]
    Other proteins in same PDB: d3wiil1, d3wiim1
    automated match to d2v7ha2

Details for d3wiim2

PDB Entry: 3wii (more details), 1.6 Å

PDB Description: crystal structure of the fab fragment of b2212a, a murine monoclonal antibody specific for the third fibronectin domain (fn3) of human robo1.
PDB Compounds: (M:) anti-human ROBO1 antibody B2212A Fab light chain

SCOPe Domain Sequences for d3wiim2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wiim2 b.1.1.2 (M:108-213) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
raeaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrne

SCOPe Domain Coordinates for d3wiim2:

Click to download the PDB-style file with coordinates for d3wiim2.
(The format of our PDB-style files is described here.)

Timeline for d3wiim2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3wiim1