SCOPe 2.05: Domain d3wxkd2: 3wxk D:263-511

Lineage for d3wxkd2 (3wxk D:263-511)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.0: automated matches [227137] (1 protein)
   not a true family

6. Protein automated matches [226839] (49 species)
   not a true protein

7. Species Trypanosoma brucei [TaxId:31285] [268052] (4 PDB entries)

8. Domain d3wxkd2: 3wxk D:263-511 [268082]
   automated match to d3h46o2
   complexed with gol, hez

Details for d3wxkd2

PDB Entry: 3wxk, 2.37 Å

PDB Description: Crystal structure of trypanosoma brucei gambiense glycerol kinase in complex with glycerol

PDB Compounds: (D:) glycerol kinase

SCOPe Domain Sequences for d3wxkd2:

Sequence; same for both SEQRES and ATOM records:

>d3wxkd2 c.55.1.0 (D:263-511) automated matches {Trypanosoma brucei [TaxId: 31285]}
mcfekgeakntygtgcfllmnvgeearfskhgllstvgfqvgrdgpcyyalegaiacaga
tvewmrrnmnlfshiteceklarsvpgtqgivfvpafsgllapywdpsargtivgmtlkt
trahviraalqaialqlndvvgsmkrdaglnlsslrvdgglskngllmeiqasllgvdil
vpsmhettalgaalcaglaagvwtsleevkavsrrenswktvspsgsamereamiaewre
alkrtkwak

Timeline for d3wxkd2:

• d3wxkd2 is new in SCOPe 2.05-stable
  
• d3wxkd2 appears in SCOPe 2.06
  
• d3wxkd2 appears in the current release, SCOPe 2.08