SCOPe 2.07: Domain d3wiim1: 3wii M:1-107

Lineage for d3wiim1 (3wii M:1-107)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (822 PDB entries)

8. Domain d3wiim1: 3wii M:1-107 [268080]
   Other proteins in same PDB: d3wiil2, d3wiim2
   automated match to d2v7ha1

Details for d3wiim1

PDB Entry: 3wii, 1.6 Å

PDB Description: crystal structure of the fab fragment of b2212a, a murine monoclonal antibody specific for the third fibronectin domain (fn3) of human robo1.

PDB Compounds: (M:) anti-human ROBO1 antibody B2212A Fab light chain

SCOPe Domain Sequences for d3wiim1:

Sequence; same for both SEQRES and ATOM records:

>d3wiim1 b.1.1.0 (M:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
diqmtqttsslsaslgdrvtiscrasqdisnflnwyqqkpdgtvklliyytsrlhsgvps
rfsgsgsgtdfsltiskleqediatyfcqqgntlpltfgagtklelk

Timeline for d3wiim1:

• d3wiim1 first appeared in SCOPe 2.05
  
• d3wiim1 appears in SCOPe 2.06
  
• d3wiim1 appears in the current release, SCOPe 2.08